OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLCXD3 (NM_001005473) Human Mass Spec Standard

Be the first to review this product
SKU
PH319570
PLCXD3 MS Standard C13 and N15-labeled recombinant protein (NP_001005473)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332282 Rabbit Polyclonal Anti-PLCXD3 Antibody
100 ul
$585.00
LY423588 Transient overexpression lysate of phosphatidylinositol-specific phospholipase C, X domain containing 3 (PLCXD3) (as WB positive control) 100 ug
$436.00

Other products for "PLCXD3 or NM_001005473"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219570
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC219570 representing NM_001005473
Red=Cloning site Green=Tags(s)

MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAK
KLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVV
FLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVALEVPFLWPGQ
MMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWV
RTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005473
RefSeq Size 7549
RefSeq ORF 963
Locus ID 345557
UniProt ID Q63HM9
Cytogenetics 5p13.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLCXD3" proteins (3)
SKU Description Size Price
LC423588 Lyophilized PLCXD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423588 Transient overexpression lysate of phosphatidylinositol-specific phospholipase C, X domain containing 3 (PLCXD3) (as WB positive control) 100 ug
$436.00
TP319570 Recombinant protein of human phosphatidylinositol-specific phospholipase C, X domain containing 3 (PLCXD3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products