OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LASS6 (CERS6) (NM_203463) Human Mass Spec Standard

Be the first to review this product
SKU
PH319555
LASS6 MS Standard C13 and N15-labeled recombinant protein (NP_982288)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404278 Transient overexpression lysate of LAG1 homolog, ceramide synthase 6 (LASS6) (as WB positive control) 100 ug
$436.00

Other products for "LASS6 or NM_203463"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219555
Predicted MW 44.7 kDa
Protein Sequence
Protein Sequence
>RC219555 representing NM_203463
Red=Cloning site Green=Tags(s)

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVAKPCAIALNIQ
ANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCESMWRFS
FYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHYYYILELSFYWSLMFSQFTDIKRKDFGIMFL
HHLVSIFLITFSYVNNMARVGTLVLCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFP
LWVLNTTLFESWEIVGPYPSWWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEE
DSEPPGKNPHTATTTNGTSGTNGYLLTGSCSMDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_982288
RefSeq Size 6259
RefSeq ORF 1152
Synonyms CERS5; LASS6
Locus ID 253782
UniProt ID Q6ZMG9
Cytogenetics 2q24.3
Summary May be involved in sphingolipid synthesis or its regulation.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LASS6" proteins (3)
SKU Description Size Price
LC404278 Lyophilized CERS6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404278 Transient overexpression lysate of LAG1 homolog, ceramide synthase 6 (LASS6) (as WB positive control) 100 ug
$436.00
TP319555 Recombinant protein of human LAG1 homolog, ceramide synthase 6 (LASS6), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products