TMUB2 (NM_024107) Human Mass Spec Standard

CAT#: PH319462

TMUB2 MS Standard C13 and N15-labeled recombinant protein (NP_077012)

Product Images

Coomassie blue staining of purified TMUB2 protein (Cat# TP319462). The protein was produced from HEK293T cells transfected with TMUB2 cDNA clone (Cat# RC219462) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219462
• Predicted MW: 31.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219462 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGDTSVLHLGHVDHLVAG
  QGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLR
  SEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL
  NITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPA
  TVSLVGVTVFFSFLVFGMYGR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077012
• RefSeq Size: 1942
• RefSeq ORF: 903
• Synonyms: FP2653
• Locus ID: 79089
• UniProt ID: Q71RG4, Q71RG4-2
• Cytogenetics: 17q21.31
• Protein Families: Druggable Genome, Transmembrane