OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMUB2 (NM_024107) Human Mass Spec Standard

Be the first to review this product
SKU
PH319462
TMUB2 MS Standard C13 and N15-labeled recombinant protein (NP_077012)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356416 TMUB2 Antibody - C-terminal region
100 ul
$585.00
LY406167 Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "TMUB2 or NM_024107"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219462
Predicted MW 31.6 kDa
Protein Sequence
Protein Sequence
>RC219462 protein sequence
Red=Cloning site Green=Tags(s)

MELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGDTSVLHLGHVDHLVAG
QGNPEPTELPHPSEGNDEKAEEAGEGRGDSTGEAGAGGGVEPSLEHLLDIQGLPKRQAGAGSSSPEAPLR
SEDSTCLPPSPGLITVRLKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSL
NITDNCVIHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTAPA
TVSLVGVTVFFSFLVFGMYGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077012
RefSeq Size 1942
RefSeq ORF 903
Synonyms FP2653
Locus ID 79089
UniProt ID Q71RG4
Cytogenetics 17q21.31
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMUB2" proteins (7)
SKU Description Size Price
LC406167 Lyophilized TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411341 Lyophilized TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421354 Lyophilized TMUB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406167 Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY411341 Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421354 Transient overexpression lysate of transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP319462 Recombinant protein of human transmembrane and ubiquitin-like domain containing 2 (TMUB2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products