OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD39 (ENTPD1) (NM_001776) Human Mass Spec Standard

Be the first to review this product
SKU
PH319359
ENTPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001767)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804559 ENTPD1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10) 100 ul
$447.00
LY431418 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "CD39 or NM_001776"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219359
Predicted MW 58 kDa
Protein Sequence
Protein Sequence
>RC219359 protein sequence
Red=Cloning site Green=Tags(s)

MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE
KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME
SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG
ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD
PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL
PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL
SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT
VAIIGLLIFHKPSYFWKDMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001767
RefSeq Size 12493
RefSeq ORF 1530
Synonyms ATPDase; CD39; NTPDase-1; SPG64
Locus ID 953
UniProt ID P49961
Cytogenetics 10q24.1
Summary The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Aug 2015
Protein Families Transmembrane
Protein Pathways Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD39" proteins (6)
SKU Description Size Price
LC431349 Lyophilized ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431418 Lyophilized ENTPD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY431349 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY431418 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP319359 Purified recombinant protein of Homo sapiens ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, 20 µg 20 ug
$737.00
TP762301 Purified recombinant protein of Human ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), transcript variant 1, Thr38-Met307, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products