OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPP40 (NM_006638) Human Mass Spec Standard

Be the first to review this product
SKU
PH319319
RPP40 MS Standard C13 and N15-labeled recombinant protein (NP_006629)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358156 RPP40 Antibody - N-terminal region
100 ul
$585.00
LY416512 Transient overexpression lysate of ribonuclease P/MRP 40kDa subunit (RPP40) (as WB positive control) 100 ug
$436.00

Other products for "RPP40 or NM_006638"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219319
Predicted MW 41.7 kDa
Protein Sequence
Protein Sequence
>RC219319 representing NM_006638
Red=Cloning site Green=Tags(s)

MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVK
NLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRK
IMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVA
LSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCT
ITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYW
LQMAVGANDHCPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006629
RefSeq Size 1174
RefSeq ORF 1089
Synonyms bA428J1.3; RNASEP1
Locus ID 10799
UniProt ID O75818
Cytogenetics 6p25.1
Summary Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:9630247, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).UniProtKB/Swiss-Prot Function
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPP40" proteins (3)
SKU Description Size Price
LC416512 Lyophilized RPP40 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416512 Transient overexpression lysate of ribonuclease P/MRP 40kDa subunit (RPP40) (as WB positive control) 100 ug
$436.00
TP319319 Recombinant protein of human ribonuclease P/MRP 40kDa subunit (RPP40), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products