OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HCST (NM_001007469) Human Mass Spec Standard

Be the first to review this product
SKU
PH319253
HCST MS Standard C13 and N15-labeled recombinant protein (NP_001007470)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402299 Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HCST or NM_001007469"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219253
Predicted MW 9.5 kDa
Protein Sequence
Protein Sequence
>RC219253 protein sequence
Red=Cloning site Green=Tags(s)

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL
CARPRRSPAQEDGKVYINMPGRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007470
RefSeq Size 521
RefSeq ORF 279
Synonyms DAP10; KAP10; PIK3AP
Locus ID 10870
UniProt ID Q9UBK5
Cytogenetics 19q13.12
Summary This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Natural killer cell mediated cytotoxicity
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HCST" proteins (5)
SKU Description Size Price
LC402299 Lyophilized HCST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423490 Lyophilized HCST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402299 Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423490 Transient overexpression lysate of hematopoietic cell signal transducer (HCST), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP319253 Recombinant protein of human hematopoietic cell signal transducer (HCST), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products