OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASPHD1 (NM_181718) Human Mass Spec Standard

Be the first to review this product
SKU
PH319226
ASPHD1 MS Standard C13 and N15-labeled recombinant protein (NP_859069)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334826 Rabbit Polyclonal Anti-ASPHD1 Antibody
100 ul
$585.00
LY405633 Transient overexpression lysate of aspartate beta-hydroxylase domain containing 1 (ASPHD1) (as WB positive control) 100 ug
$436.00

Other products for "ASPHD1 or NM_181718"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219226
Predicted MW 41.1 kDa
Protein Sequence
Protein Sequence
>RC219226 protein sequence
Red=Cloning site Green=Tags(s)

MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGLLARASLIMLP
WPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPVGCSEAGGPSPGGPGDPGEGP
RTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPGVLGIQRPGLLFLPDLPSAPFVPRDAQRHDV
ELLESSFPAILRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRS
FMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHT
VAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVFAPDP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859069
RefSeq Size 1562
RefSeq ORF 1170
Locus ID 253982
UniProt ID Q5U4P2
Cytogenetics 16p11.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASPHD1" proteins (3)
SKU Description Size Price
LC405633 Lyophilized ASPHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405633 Transient overexpression lysate of aspartate beta-hydroxylase domain containing 1 (ASPHD1) (as WB positive control) 100 ug
$436.00
TP319226 Recombinant protein of human aspartate beta-hydroxylase domain containing 1 (ASPHD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products