OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SHF (NM_138356) Human Mass Spec Standard

Be the first to review this product
SKU
PH319220
SHF MS Standard C13 and N15-labeled recombinant protein (NP_612365)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343294 Rabbit Polyclonal Anti-SHF Antibody
100 ul
$585.00
LY408628 Transient overexpression lysate of Src homology 2 domain containing F (SHF) (as WB positive control) 100 ug
$665.00

Other products for "SHF or NM_138356"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219220
Predicted MW 46.6 kDa
Protein Sequence
Protein Sequence
>RC219220 representing NM_138356
Red=Cloning site Green=Tags(s)

MQQEGGPVRSAPCRTGTLEGSRQGSPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHREPISSSPQPV
ANGPKQKKKSNWRSTTRLRIIRLRDRLEPRPLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGYMEP
YEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKE
RISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGRE
EKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNS
ETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAI
RTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612365
RefSeq Size 2517
RefSeq ORF 1269
Locus ID 90525
UniProt ID B3KTY1
Cytogenetics 15q21.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SHF" proteins (3)
SKU Description Size Price
LC408628 Lyophilized SHF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408628 Transient overexpression lysate of Src homology 2 domain containing F (SHF) (as WB positive control) 100 ug
$665.00
TP319220 Recombinant protein of human Src homology 2 domain containing F (SHF), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products