OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LAMP1 (NM_005561) Human Mass Spec Standard

Be the first to review this product
SKU
PH319208
LAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_005552)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811973 LAMP1 mouse monoclonal antibody,clone OTI8B1 100 ul
$447.00
LY417223 Transient overexpression lysate of lysosomal-associated membrane protein 1 (LAMP1) (as WB positive control) 100 ug
$436.00

Other products for "LAMP1 or NM_005561"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219208
Predicted MW 44.88 kDa
Protein Sequence
Protein Sequence
>RC219208 representing NM_005561
Red=Cloning site Green=Tags(s)

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD
ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE
SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP
SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005552
RefSeq Size 2560
RefSeq ORF 1251
Synonyms CD107a; LAMPA; LGP120
Locus ID 3916
UniProt ID P11279
Cytogenetics 13q34
Summary The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. provided by RefSeq, Jul 2008
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Lysosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LAMP1" proteins (4)
SKU Description Size Price
LC417223 Lyophilized LAMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417223 Transient overexpression lysate of lysosomal-associated membrane protein 1 (LAMP1) (as WB positive control) 100 ug
$436.00
TP319208 Recombinant protein of human lysosomal-associated membrane protein 1 (LAMP1), 20 µg 20 ug
$867.00
TP720401 Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 1 (LAMP1) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products