OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Clathrin light chain (CLTA) (NM_007096) Human Mass Spec Standard

Be the first to review this product
SKU
PH319035
CLTA MS Standard C13 and N15-labeled recombinant protein (NP_009027)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809578 CLTA mouse monoclonal antibody,clone OTI2D12 100 ul
$447.00
LY400696 Transient overexpression lysate of clathrin, light chain (Lca) (CLTA), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Clathrin light chain or NM_007096"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219035
Predicted MW 26.9 kDa
Protein Sequence
Protein Sequence
>RC219035 representing NM_007096
Red=Cloning site Green=Tags(s)

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG
GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI
KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTE
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009027
RefSeq Size 1105
RefSeq ORF 744
Synonyms LCA
Locus ID 1211
UniProt ID P09496
Cytogenetics 9p13.3
Summary Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. provided by RefSeq, May 2010
Protein Pathways Endocytosis, Huntington's disease, Lysosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Clathrin light chain" proteins (6)
SKU Description Size Price
LC400696 Lyophilized CLTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416209 Lyophilized CLTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400696 Transient overexpression lysate of clathrin, light chain (Lca) (CLTA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY416209 Transient overexpression lysate of clathrin, light chain (Lca) (CLTA), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP319035 Recombinant protein of human clathrin, light chain (Lca) (CLTA), transcript variant 2, 20 µg 20 ug
$867.00
TP760082 Recombinant protein of human clathrin, light chain (Lca) (CLTA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products