OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DMRTB1 (NM_033067) Human Mass Spec Standard

Be the first to review this product
SKU
PH318956
DMRTB1 MS Standard C13 and N15-labeled recombinant protein (NP_149056)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA341426 Rabbit Polyclonal Anti-DMRTB1 Antibody
100 ul
$525.00
LY409776 Transient overexpression lysate of DMRT-like family B with proline-rich C-terminal, 1 (DMRTB1) (as WB positive control) 100 ug
$436.00

Other products for "DMRTB1 or NM_033067"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218956
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC218956 representing NM_033067
Red=Cloning site Green=Tags(s)

MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALC
AQGPKQASGAAAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFFEQPPRGRNPGPRALQPVLGG
RSHVEPSERAAVAMPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPG
GSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQ
PQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_149056
RefSeq Size 1907
RefSeq ORF 1026
Locus ID 63948
UniProt ID Q96MA1
Cytogenetics 1p32.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DMRTB1" proteins (3)
SKU Description Size Price
LC409776 Lyophilized DMRTB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409776 Transient overexpression lysate of DMRT-like family B with proline-rich C-terminal, 1 (DMRTB1) (as WB positive control) 100 ug
$436.00
TP318956 Recombinant protein of human DMRT-like family B with proline-rich C-terminal, 1 (DMRTB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products