OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RTL8B (NM_001078173) Human Mass Spec Standard

Be the first to review this product
SKU
PH318852
FAM127C MS Standard C13 and N15-labeled recombinant protein (NP_001071641)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502175 FAM127C mouse monoclonal antibody, clone OTI1A6 (formerly 1A6) 100 ul
$447.00
LY421496 Transient overexpression lysate of family with sequence similarity 127, member C (FAM127C) (as WB positive control) 100 ug
$436.00

Other products for "RTL8B or NM_001078173"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218852
Predicted MW 13.2 kDa
Protein Sequence
Protein Sequence
>RC218852 protein sequence
Red=Cloning site Green=Tags(s)

MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLIT
RLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001071641
RefSeq Size 2038
RefSeq ORF 339
Synonyms CXX1c; FAM127C; MAR8B; SIRH4
Locus ID 441518
UniProt ID Q17RB0
Cytogenetics Xq26.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RTL8B" proteins (3)
SKU Description Size Price
LC421496 Lyophilized FAM127C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY421496 Transient overexpression lysate of family with sequence similarity 127, member C (FAM127C) (as WB positive control) 100 ug
$436.00
TP318852 Recombinant protein of human family with sequence similarity 127, member C (FAM127C), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products