OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ADAMTSL1 (NM_052866) Human Mass Spec Standard

Be the first to review this product
SKU
PH318828
ADAMTSL1 MS Standard C13 and N15-labeled recombinant protein (NP_443098)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323346 Anti-ADAMTSL1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY409424 Transient overexpression lysate of ADAMTS-like 1 (ADAMTSL1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "ADAMTSL1 or NM_052866"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218828
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>RC218828 protein sequence
Red=Cloning site Green=Tags(s)

MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRN
IRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQFYEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLD
GTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNCGVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPY
GSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTGTFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIR
NSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK
LQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKC
MYTPKMPIAQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHIKEECIVPT
PCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443098
RefSeq Size 1810
RefSeq ORF 1575
Synonyms ADAMTSL-1; ADAMTSR1; C9orf94; PUNCTIN
Locus ID 92949
UniProt ID Q8N6G6
Cytogenetics 9p22.2-p22.1
Summary This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ADAMTSL1" proteins (4)
SKU Description Size Price
LC409424 Lyophilized ADAMTSL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409424 Transient overexpression lysate of ADAMTS-like 1 (ADAMTSL1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP318828 Purified recombinant protein of Homo sapiens ADAMTS-like 1 (ADAMTSL1), transcript variant 2, 20 µg 20 ug
$867.00
TP761080 Purified recombinant protein of Human ADAMTS-like 1 (ADAMTSL1), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products