OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STK19 (NM_004197) Human Mass Spec Standard

Be the first to review this product
SKU
PH318770
STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382124 STK19 Rabbit polyclonal Antibody
100 ul
$410.00
LY410091 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "STK19 or NM_004197"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218770
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC218770 representing NM_004197
Red=Cloning site Green=Tags(s)

MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG
GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR
GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH
GIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRD
AGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC
ISTTSGTLLRLPET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004188
RefSeq Size 1620
RefSeq ORF 1092
Synonyms D6S60; D6S60E; G11; HLA-RP1; RP1
Locus ID 8859
UniProt ID P49842
Cytogenetics 6p21.33
Summary This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STK19" proteins (5)
SKU Description Size Price
LC410091 Lyophilized STK19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418155 Lyophilized STK19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410091 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418155 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP318770 Purified recombinant protein of Homo sapiens serine/threonine kinase 19 (STK19), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products