STK19 (NM_004197) Human Mass Spec Standard

SKU
PH318770
STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218770]
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC218770 representing NM_004197
Red=Cloning site Green=Tags(s)

MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG
GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR
GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH
GIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRD
AGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC
ISTTSGTLLRLPET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004188
RefSeq Size 1620
RefSeq ORF 1092
Synonyms D6S60; D6S60E; G11; HLA-RP1; RP1
Locus ID 8859
UniProt ID P49842
Cytogenetics 6p21.33
Summary This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:STK19 (NM_004197) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410091 STK19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418155 STK19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410091 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 100 ug
$436.00
LY418155 Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 1 100 ug
$436.00
TP318770 Purified recombinant protein of Homo sapiens serine/threonine kinase 19 (STK19), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.