OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

INMT (NM_006774) Human Mass Spec Standard

Be the first to review this product
SKU
PH318678
INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377510 INMT Rabbit polyclonal Antibody
100 ul
$410.00
LY416430 Transient overexpression lysate of indolethylamine N-methyltransferase (INMT) (as WB positive control) 100 ug
$436.00

Other products for "INMT or NM_006774"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218678
Predicted MW 28.7 kDa
Protein Sequence
Protein Sequence
>RC218678 representing NM_006774
Red=Cloning site Green=Tags(s)

MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ
VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK
CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKRE
FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006765
RefSeq Size 2639
RefSeq ORF 789
Synonyms TEMT
Locus ID 11185
UniProt ID O95050
Cytogenetics 7p14.3
Summary N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera. provided by RefSeq, Jul 2019
Protein Pathways Tryptophan metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "INMT" proteins (4)
SKU Description Size Price
LC416430 Lyophilized INMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416430 Transient overexpression lysate of indolethylamine N-methyltransferase (INMT) (as WB positive control) 100 ug
$436.00
TP318678 Recombinant protein of human indolethylamine N-methyltransferase (INMT), 20 µg 20 ug
$737.00
TP761226 Purified recombinant protein of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products