OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPRED3 (NM_001039616) Human Mass Spec Standard

Be the first to review this product
SKU
PH318601
SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306664 Rabbit Polyclonal Spred3 Antibody
100 ug
$640.00
LY420960 Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPRED3 or NM_001039616"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218601
Predicted MW 16.1 kDa
Protein Sequence
Protein Sequence
>RC218601 representing NM_001039616
Red=Cloning site Green=Tags(s)

MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGL
VYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPL
TLSQYFRHMLCP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034705
RefSeq Size 543
RefSeq ORF 456
Synonyms Eve-3; spred-3
Locus ID 399473
UniProt ID Q2MJR0
Cytogenetics 19q13.2
Summary This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively regulates mitogen-activated protein (MAP) kinase signaling, particularly during organogenesis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPRED3" proteins (5)
SKU Description Size Price
LC420960 Lyophilized SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422092 Lyophilized SPRED3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420960 Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422092 Transient overexpression lysate of sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318601 Recombinant protein of human sprouty-related, EVH1 domain containing 3 (SPRED3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products