OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSORS1C1 (NM_014068) Human Mass Spec Standard

Be the first to review this product
SKU
PH318532
PSORS1C1 MS Standard C13 and N15-labeled recombinant protein (NP_054787)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357035 PSORS1C1 Antibody - N-terminal region
100 ul
$585.00
LY415493 Transient overexpression lysate of psoriasis susceptibility 1 candidate 1 (PSORS1C1) (as WB positive control) 100 ug
$436.00

Other products for "PSORS1C1 or NM_014068"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218532
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC218532 representing NM_014068
Red=Cloning site Green=Tags(s)

MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH
LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP
PSHSPFGLSSLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054787
RefSeq Size 861
RefSeq ORF 456
Synonyms C6orf16; SEEK1
Locus ID 170679
UniProt ID Q9UIG5
Cytogenetics 6p21.33
Summary This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region. provided by RefSeq, Sep 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSORS1C1" proteins (3)
SKU Description Size Price
LC415493 Lyophilized PSORS1C1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415493 Transient overexpression lysate of psoriasis susceptibility 1 candidate 1 (PSORS1C1) (as WB positive control) 100 ug
$436.00
TP318532 Recombinant protein of human psoriasis susceptibility 1 candidate 1 (PSORS1C1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products