OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX27 (NM_030918) Human Mass Spec Standard

Be the first to review this product
SKU
PH318477
SNX27 MS Standard C13 and N15-labeled recombinant protein (NP_112180)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369364 SNX27 rabbit polyclonal antibody
100 ul
$310.00
LY403094 Transient overexpression lysate of sorting nexin family member 27 (SNX27) (as WB positive control) 100 ug
$665.00

Other products for "SNX27 or NM_030918"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218477
Predicted MW 59.6 kDa
Protein Sequence
Protein Sequence
>RC218477 representing NM_030918
Red=Cloning site Green=Tags(s)

MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSI
NGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEA
DNLDPSDDSLGQSFYDYTEKQAVPISVPRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAILHQNLKRE
FANFTFPRLPGKWPFSLSEQQLDARRRGLEEYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVA
LPDGTTVTVRVKKNSTTDQVYQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAV
PGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEY
ARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112180
RefSeq Size 7085
RefSeq ORF 1584
Synonyms MRT1; MY014
Locus ID 81609
UniProt ID Q96L92
Cytogenetics 1q21.3
Summary This gene encodes a member of the sorting nexin family, a diverse group of cytoplasmic and membrane-associated proteins involved in endocytosis of plasma membrane receptors and protein trafficking through these compartments. All members of this protein family contain a phosphoinositide binding domain (PX domain). A highly similar protein in mouse is responsible for the specific recruitment of an isoform of serotonin 5-hydroxytryptamine 4 receptor into early endosomes, suggesting the analogous role for the human protein. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX27" proteins (3)
SKU Description Size Price
LC403094 Lyophilized SNX27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403094 Transient overexpression lysate of sorting nexin family member 27 (SNX27) (as WB positive control) 100 ug
$665.00
TP318477 Recombinant protein of human sorting nexin family member 27 (SNX27), 20 µg 20 ug
$737.00

file-alt Citations

A role for sorting nexin 27 in AMPA receptor trafficking
Loo, Tang, Al-Haddawi et al
Nat Commun (2014) 5, 3176 DOI: 10.1038/ncomms4176
Cited by 114
AI Summary: OriGene’s human SNX27 cDNA was used to generate GFP-SNX27 and mCherry-SNX27 constructs, enabling the study of SNX27’s localization and role in AMPA receptor trafficking in this paper.
Snippet: GFP-SNX27 and mCherry SNX27 were generated by subcloning human SNX27 (Origene) into pEGFP-N1 or pmCherry-N1 (Clontech) using Bgl11 and BamH1
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products