OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C16orf86 (NM_001012984) Human Mass Spec Standard

Be the first to review this product
SKU
PH318379
C16orf86 MS Standard C13 and N15-labeled recombinant protein (NP_001013002)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422945 Transient overexpression lysate of chromosome 16 open reading frame 86 (C16orf86) (as WB positive control) 100 ug
$436.00

Other products for "C16orf86 or NM_001012984"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218379
Predicted MW 33.3 kDa
Protein Sequence
Protein Sequence
>RC218379 representing NM_001012984
Red=Cloning site Green=Tags(s)

MASAGAERRPGVQEATVVGQGQLTEEPGSAQTSECPVAGDQFLVPAHEARGTQSEDQRPAGAASESELQE
EGPKLGEERPKPHAGALEERGPRPVVSIVRPRHGPKRKPVKSLSLPGLRAHLKAEAELPPKLPLQEEEPE
DSQSEPSPSAKQHKKAKKRKSLGAPVLHAVASMVSAPLETLRLERKAQRLRPLYQYVNYCNPELNQAGKG
DGEAEVEAEAELAPVPEEGGVEQLQALLPLAGELGPGLALPCPSPLVTPTHALAPLGEEAGEEPGGLPSL
GVSDHKAEVDKSTQVDIDKMLSVCTAPLVPPLSPQYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001013002
RefSeq Size 1287
RefSeq ORF 951
Locus ID 388284
UniProt ID Q6ZW13
Cytogenetics 16q22.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C16orf86" proteins (3)
SKU Description Size Price
LC422945 Lyophilized C16orf86 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422945 Transient overexpression lysate of chromosome 16 open reading frame 86 (C16orf86) (as WB positive control) 100 ug
$436.00
TP318379 Recombinant protein of human chromosome 16 open reading frame 86 (C16orf86), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products