OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HPR (NM_020995) Human Mass Spec Standard

Be the first to review this product
SKU
PH318300
HPR MS Standard C13 and N15-labeled recombinant protein (NP_066275)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368520 HPR rabbit polyclonal antibody
100 ul
$310.00
LY412112 Transient overexpression lysate of haptoglobin-related protein (HPR) (as WB positive control) 100 ug
$436.00

Other products for "HPR or NM_020995"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218300
Predicted MW 38.8 kDa
Protein Sequence
Protein Sequence
>RC218300 representing NM_020995
Red=Cloning site Green=Tags(s)

MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN
DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL
TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP
SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT
FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066275
RefSeq Size 1245
RefSeq ORF 1044
Synonyms A-259H10.2; HP
Locus ID 3250
UniProt ID P00739
Cytogenetics 16q22.2
Summary This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer. provided by RefSeq, Oct 2011
Protein Families Druggable Genome, Protease, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HPR" proteins (4)
SKU Description Size Price
LC412112 Lyophilized HPR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412112 Transient overexpression lysate of haptoglobin-related protein (HPR) (as WB positive control) 100 ug
$436.00
TP318300 Recombinant protein of human haptoglobin-related protein (HPR), 20 µg 20 ug
$737.00
TP750140 Purified recombinant protein of Human haptoglobin-related protein (HPR),Leu20-End, with N-terminal His tag, expressed in E. coli, 100ug 100 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products