OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OS9 (NM_006812) Human Mass Spec Standard

Be the first to review this product
SKU
PH318206
OS9 MS Standard C13 and N15-labeled recombinant protein (NP_006803)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350253 Rabbit Polyclonal Anti-OS9 Antibody
100 ul
$205.00
LY402037 Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "OS9 or NM_006812"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218206
Predicted MW 75.56 kDa
Protein Sequence
Protein Sequence
>RC218206 representing NM_006812
Red=Cloning site Green=Tags(s)

MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQR
YECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKG
EVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRV
DEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLG
PQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDF
QNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDED
EDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAM
LALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVL
EMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGA
EEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006803
RefSeq Size 2721
RefSeq ORF 2001
Synonyms ERLEC2; OS-9
Locus ID 10956
UniProt ID Q13438
Cytogenetics 12q13.3-q14.1
Summary This gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OS9" proteins (7)
SKU Description Size Price
PH316820 OS9 MS Standard C13 and N15-labeled recombinant protein (NP_001017958) 10 ug
$3,360.00
LC402037 Lyophilized OS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422763 Lyophilized OS9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402037 Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY422763 Transient overexpression lysate of osteosarcoma amplified 9, endoplasmic reticulum lectin (OS9), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP316820 Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 4, 20 µg 20 ug
$737.00
TP318206 Recombinant protein of human osteosarcoma amplified 9, endoplasmic reticulum associated protein (OS9), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products