OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PELI3 (NM_145065) Human Mass Spec Standard

Be the first to review this product
SKU
PH318104
PELI3 MS Standard C13 and N15-labeled recombinant protein (NP_659502)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334993 Rabbit Polyclonal Anti-PELI3 Antibody
100 ul
$585.00
LY408053 Transient overexpression lysate of pellino homolog 3 (Drosophila) (PELI3), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "PELI3 or NM_145065"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218104
Predicted MW 50.6 kDa
Protein Sequence
Protein Sequence
>RC218104 representing NM_145065
Red=Cloning site Green=Tags(s)

MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLGCCEEGGEETEAQRGEVTGP
RAHSCYNGCLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIV
EYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDA
SSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKL
VENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTA
PDKQQPWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGH
VCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659502
RefSeq Size 2697
RefSeq ORF 1407
Locus ID 246330
UniProt ID Q8N2H9
Cytogenetics 11q13.2
Summary The protein encoded by this gene is a scaffold protein and an intermediate signaling protein in the innate immune response pathway. The encoded protein helps transmit the immune response signal from Toll-like receptors to IRAK1/TRAF6 complexes. Several transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, Jul 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PELI3" proteins (3)
SKU Description Size Price
LC408053 Lyophilized PELI3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408053 Transient overexpression lysate of pellino homolog 3 (Drosophila) (PELI3), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP318104 Recombinant protein of human pellino homolog 3 (Drosophila) (PELI3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products