OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ODAPH (NM_178497) Human Mass Spec Standard

Be the first to review this product
SKU
PH318037
C4orf26 MS Standard C13 and N15-labeled recombinant protein (NP_848592)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334793 Rabbit Polyclonal Anti-C4orf26 Antibody
100 ul
$585.00
LY405890 Transient overexpression lysate of chromosome 4 open reading frame 26 (C4orf26) (as WB positive control) 100 ug
$436.00

Other products for "ODAPH or NM_178497"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218037
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC218037 protein sequence
Red=Cloning site Green=Tags(s)

MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRC
PFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848592
RefSeq Size 1882
RefSeq ORF 390
Synonyms AI2A4; C4orf26
Locus ID 152816
UniProt ID Q17RF5
Cytogenetics 4q21.1
Summary Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene is thought to encode an extracellular matrix acidic phosphoprotein that has a function in enamel mineralization during amelogenesis. Mutations in this gene are associated with recessive hypomineralized amelogenesis imperfecta. provided by RefSeq, Oct 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ODAPH" proteins (3)
SKU Description Size Price
LC405890 Lyophilized C4orf26 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405890 Transient overexpression lysate of chromosome 4 open reading frame 26 (C4orf26) (as WB positive control) 100 ug
$436.00
TP318037 Recombinant protein of human chromosome 4 open reading frame 26 (C4orf26), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products