OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HOATZ (NM_207430) Human Mass Spec Standard

Be the first to review this product
SKU
PH317907
C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404031 Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HOATZ or NM_207430"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217907
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC217907 representing NM_207430
Red=Cloning site Green=Tags(s)

METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPR
RSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQ
AKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997313
RefSeq Size 800
RefSeq ORF 588
Synonyms C11orf88
Locus ID 399949
UniProt ID Q6PI97
Cytogenetics 11q23.1
Summary Required for motile ciliogenesis and flagellar genesis by mediating the maturation of the glycolytic enzyme ENO4.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HOATZ" proteins (5)
SKU Description Size Price
LC404031 Lyophilized C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420240 Lyophilized C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404031 Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420240 Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP317907 Recombinant protein of human chromosome 11 open reading frame 88 (C11orf88), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products