OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LIGHT (TNFSF14) (NM_003807) Human Mass Spec Standard

Be the first to review this product
SKU
PH317759
TNFSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003798)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355109 Mouse Monoclonal Anti-LIGHT Antibody [7B9F12]
100 ug
$640.00
LY418409 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LIGHT or NM_003807"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217759
Predicted MW 26.35 kDa
Protein Sequence
Protein Sequence
>RC217759 protein sequence
Red=Cloning site Green=Tags(s)

MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVT
RLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGY
YYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLE
AGEEVVVRVLDERLVRLRDGTRSYFGAFMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003798
RefSeq Size 1491
RefSeq ORF 720
Synonyms CD258; HVEML; LIGHT; LTg
Locus ID 8740
UniProt ID O43557
Cytogenetics 19p13.3
Summary The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LIGHT" proteins (3)
SKU Description Size Price
LC418409 Lyophilized TNFSF14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418409 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP317759 Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products