OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEPTIN14 (NM_207366) Human Mass Spec Standard

Be the first to review this product
SKU
PH317721
SEPT14 MS Standard C13 and N15-labeled recombinant protein (NP_997249)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316377 Rabbit polyclonal anti-SEPT14 antibody
100 ul
$380.00
LY403987 Transient overexpression lysate of septin 14 (SEPT14) (as WB positive control) 100 ug
$665.00

Other products for "SEPTIN14 or NM_207366"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217721
Predicted MW 49.8 kDa
Protein Sequence
Protein Sequence
>RC217721 representing NM_207366
Red=Cloning site Green=Tags(s)

MAERTMAMPTQIPADGDTQKENNIRCLTTIGHFGFECLPNQLVSRSIRQGFTFNILCVGETGIGKSTLID
TLFNTNLKDNKSSHFYSNVGLQIQTYELQESNVQLKLTVVETVGYGDQIDKEASYQPIVDYIDAQFEAYL
QEELKIKRSLFEYHDSRVHVCLYFISPTGHSLKSLDLLTMKNLDSKVNIIPLIAKADTISKNDLQTFKNK
IMSELISNGIQIYQLPTDEETAAQANSSVSGLLPFAVVGSTDEVKVGKRMVRGRHYPWGVLQVENENHCD
FVKLRDMLLCTNMENLKEKTHTQHYECYRYQKLQKMGFTDVGPNNQPVSFQEIFEAKRQEFYDQCQREEE
ELKQRFMQRVKEKEATFKEAEKELQDKFEHLKMIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQL
STDTKKDKHRKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997249
RefSeq Size 3785
RefSeq ORF 1296
Synonyms SEPT14
Locus ID 346288
UniProt ID Q6ZU15
Cytogenetics 7p11.2
Summary SEPT14 is a member of the highly conserved septin family of GTP-binding cytoskeletal proteins implicated in membrane transport, apoptosis, cell polarity, cell cycle regulation, cytokinesis, and other cellular functions (Peterson et al., 2007 PubMed 17922164).supplied by OMIM, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEPTIN14" proteins (3)
SKU Description Size Price
LC403987 Lyophilized 42261 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403987 Transient overexpression lysate of septin 14 (SEPT14) (as WB positive control) 100 ug
$665.00
TP317721 Recombinant protein of human septin 14 (SEPT14), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products