OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNPS1 (NM_006711) Human Mass Spec Standard

Be the first to review this product
SKU
PH317673
RNPS1 MS Standard C13 and N15-labeled recombinant protein (NP_006702)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359415 RNPS1 Antibody - N-terminal region
100 ul
$585.00
LY409141 Transient overexpression lysate of RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RNPS1 or NM_006711"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217673
Predicted MW 34 kDa
Protein Sequence
Protein Sequence
>RC217673 representing NM_006711
Red=Cloning site Green=Tags(s)

MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASS
GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK
SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF
ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR
SPVRRRSRSPGRRRHRSRSSSNSSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006702
RefSeq Size 2038
RefSeq ORF 915
Synonyms E5.1
Locus ID 10921
UniProt ID Q15287
Cytogenetics 16p13.3
Summary This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2013
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNPS1" proteins (7)
SKU Description Size Price
PH315882 RNPS1 MS Standard C13 and N15-labeled recombinant protein (NP_542161) 10 ug
$3,360.00
LC409141 Lyophilized RNPS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416470 Lyophilized RNPS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409141 Transient overexpression lysate of RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY416470 Transient overexpression lysate of RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315882 Recombinant protein of human RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 2, 20 µg 20 ug
$867.00
TP317673 Recombinant protein of human RNA binding protein S1, serine-rich domain (RNPS1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products