OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACCN2 (ASIC1) (NM_001095) Human Mass Spec Standard

Be the first to review this product
SKU
PH317623
ACCN2 MS Standard C13 and N15-labeled recombinant protein (NP_001086)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338589 Rabbit Polyclonal Anti-ACCN2 Antibody
100 ul
$585.00
LY420121 Transient overexpression lysate of amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "ACCN2 or NM_001095"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217623
Predicted MW 59.9 kDa
Protein Sequence
Protein Sequence
>RC217623 protein sequence
Red=Cloning site Green=Tags(s)

MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFH
YHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQD
KANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM
KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL
IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL
DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDD
VKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001086
RefSeq Size 3873
RefSeq ORF 1584
Synonyms ACCN2; ASIC; BNaC2
Locus ID 41
UniProt ID P78348
Cytogenetics 12q13.12
Summary This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2012
Protein Families Druggable Genome, Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACCN2" proteins (3)
SKU Description Size Price
LC420121 Lyophilized ASIC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420121 Transient overexpression lysate of amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP317623 Recombinant protein of human amiloride-sensitive cation channel 2, neuronal (ACCN2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products