OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYTL2 (NM_032943) Human Mass Spec Standard

Be the first to review this product
SKU
PH317584
SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_116561)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360457 SYTL2 Antibody - middle region
100 ul
$585.00
LY403206 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a (as WB positive control) 100 ug
$665.00

Other products for "SYTL2 or NM_032943"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217584
Predicted MW 102.4 kDa
Protein Sequence
Protein Sequence
>RC217584 representing NM_032943
Red=Cloning site Green=Tags(s)

MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD
IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV
IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS
IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS
STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG
REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL
HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE
EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDDEKPDQKPVTNECVPRISTVPT
QPDNPFSHPDKLKRMSKSVPAFLQDEVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKD
LAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTF
KRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEV
HIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVEL
TVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116561
RefSeq Size 3985
RefSeq ORF 2733
Synonyms CHR11SYT; EXO4; PPP1R151; SGA72M; SLP2; SLP2A
Locus ID 54843
UniProt ID Q9HCH5
Cytogenetics 11q14.1
Summary The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.provided by RefSeq, Jun 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYTL2" proteins (13)
SKU Description Size Price
PH317701 SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812) 10 ug
$3,360.00
PH318076 SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755) 10 ug
$3,360.00
LC403206 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404177 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404178 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410172 Lyophilized SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403206 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a (as WB positive control) 100 ug
$665.00
LY404177 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e (as WB positive control) 100 ug
$436.00
LY404178 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f (as WB positive control) 100 ug
$436.00
LY410172 Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b (as WB positive control) 100 ug
$436.00
TP317584 Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant a, 20 µg 20 ug
$737.00
TP317701 Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant e, 20 µg 20 ug
$737.00
TP318076 Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant b, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products