OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KLC4 (NM_201522) Human Mass Spec Standard

Be the first to review this product
SKU
PH317567
KLC4 MS Standard C13 and N15-labeled recombinant protein (NP_958930)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337394 Rabbit Polyclonal Anti-KLC4 Antibody
100 ul
$585.00
LY404434 Transient overexpression lysate of kinesin light chain 4 (KLC4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "KLC4 or NM_201522"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217567
Predicted MW 68.6 kDa
Protein Sequence
Protein Sequence
>RC217567 protein sequence
Red=Cloning site Green=Tags(s)

MSGLVLGQRDEPAGHRLSQEEILGSTRLVSQGLEALRSEHQAVLQSLSQTIECLQQGGHEEGLVHEKARQ
LRRSMENIELGLSEAQVMLALASHLSTVESEKQKLRAQVRRLCQENQWLRDELAGTQQRLQRSEQAVAQL
EEEKKHLEFLGQLRQYDEDGHTSEEKEGDATKDSLDDLFPNEEEEDPSNGLSRGQGATAAQQGGYEIPAR
LRTLHNLVIQYAAQGRYEVAVPLCKQALEDLERTSGRGHPDVATMLNILALVYRDQNKYKEAAHLLNDAL
SIRESTLGPDHPAVAATLNNLAVLYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKQLNNLALLCQNQ
GKYEAVERYYQRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEILTRAHVQEFGSVDDD
HKPIWMHAEEREEMSKSRHHEGGTPYAEYGGWYKACKVSSPTVNTTLRNLGALYRRQGKLEAAETLEECA
LRSRRQGTDPISQTKVAELLGESDGRRTSQEGPGDSVKFEGGEDASVAVEWSGDGSGTLQRSGSLGKIRD
VLRRSSELLVRKLQGTEPRPSSSNMKRAASLNYLNQPSAAPLQVSRGLSASTMDLSSSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958930
RefSeq Size 2820
RefSeq ORF 1857
Synonyms bA387M24.3; KNSL8
Locus ID 89953
UniProt ID Q9NSK0
Cytogenetics 6p21.1
Summary Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KLC4" proteins (7)
SKU Description Size Price
PH310268 KLC4 MS Standard C13 and N15-labeled recombinant protein (NP_958929) 10 ug
$3,360.00
LC404434 Lyophilized KLC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404435 Lyophilized KLC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404434 Transient overexpression lysate of kinesin light chain 4 (KLC4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404435 Transient overexpression lysate of kinesin light chain 4 (KLC4), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP310268 Recombinant protein of human kinesin light chain 4 (KLC4), transcript variant 1, 20 µg 20 ug
$737.00
TP317567 Recombinant protein of human kinesin light chain 4 (KLC4), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products