OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Asialoglycoprotein Receptor 2 (ASGR2) (NM_080914) Human Mass Spec Standard

Be the first to review this product
SKU
PH317541
ASGR2 MS Standard C13 and N15-labeled recombinant protein (NP_550436)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505099 ASGR2 (Asialoglycoprotein Receptor 2) mouse monoclonal antibody, clone OTI2A12 (formerly 2A12) 100 ul
$447.00
LY420082 Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Asialoglycoprotein Receptor 2 or NM_080914"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217541
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC217541 representing NM_080914
Red=Cloning site Green=Tags(s)

MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCFSLLALSFNILLLVVICVTGSQSEGHRGAQL
QAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRF
VACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTN
PFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWV
CEKRRNATGEVA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_550436
RefSeq Size 1202
RefSeq ORF 876
Synonyms ASGP-R2; ASGPR2; CLEC4H2; HBXBP; HL-2
Locus ID 433
UniProt ID P07307
Cytogenetics 17p13.1
Summary This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jan 2011
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Asialoglycoprotein Receptor 2" proteins (11)
SKU Description Size Price
PH313607 ASGR2 MS Standard C13 and N15-labeled recombinant protein (NP_001172) 10 ug
$3,360.00
LC408999 Lyophilized ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409000 Lyophilized ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409001 Lyophilized ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420082 Lyophilized ASGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408999 Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant H2' (as WB positive control) 100 ug
$436.00
LY409000 Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409001 Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420082 Transient overexpression lysate of asialoglycoprotein receptor 2 (ASGR2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP313607 Purified recombinant protein of Homo sapiens asialoglycoprotein receptor 2 (ASGR2), transcript variant 1, 20 µg 20 ug
$867.00
TP317541 Recombinant protein of human asialoglycoprotein receptor 2 (ASGR2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products