OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LY6G6F (NM_001003693) Human Mass Spec Standard

Be the first to review this product
SKU
PH317067
LY6G6F MS Standard C13 and N15-labeled recombinant protein (NP_001003693)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335306 Rabbit Polyclonal Anti-C6orf21 Antibody
100 ul
$525.00
LY423981 Transient overexpression lysate of lymphocyte antigen 6 complex, locus G6F (LY6G6F) (as WB positive control) 100 ug
$436.00

Other products for "LY6G6F or NM_001003693"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217067
Predicted MW 32.46 kDa
Protein Sequence
Protein Sequence
>RC217067 representing NM_001003693
Red=Cloning site Green=Tags(s)

MAVLFLLLFLCGTPQAADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRP
APDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSP
CNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGV
SFSLAASIDASPALCAPSTGWDMPWILMLLLTMGQGVVILALSIVLWRQRVRGAPGRDASIPQFKPEIQV
YENIHLARLGPPAHKPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003693
RefSeq Size 898
RefSeq ORF 891
Synonyms C6orf21; G6f; LY6G6; LY6G6D; NG32
Locus ID 259215
UniProt ID Q5SQ64
Cytogenetics 6p21.33
Summary The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 PubMed 12852788).supplied by OMIM, Mar 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LY6G6F" proteins (3)
SKU Description Size Price
LC423981 Lyophilized LY6G6F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423981 Transient overexpression lysate of lymphocyte antigen 6 complex, locus G6F (LY6G6F) (as WB positive control) 100 ug
$436.00
TP317067 Recombinant protein of human lymphocyte antigen 6 complex, locus G6F (LY6G6F), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products