OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHETA2 (NM_001002034) Human Mass Spec Standard

Be the first to review this product
SKU
PH316895
FAM109B MS Standard C13 and N15-labeled recombinant protein (NP_001002034)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY424173 Transient overexpression lysate of family with sequence similarity 109, member B (FAM109B) (as WB positive control) 100 ug
$436.00

Other products for "PHETA2 or NM_001002034"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216895
Predicted MW 28.2 kDa
Protein Sequence
Protein Sequence
>RC216895 representing NM_001002034
Red=Cloning site Green=Tags(s)

MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREGRAPLSLVVLE
GCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRASFGYMRLVVRELESQLQDARQ
SLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSSPVGLVEEAGSRSAGWGLAEWELQGPASLLL
GKGQSPVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSHSKCEEQDRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001002034
RefSeq Size 2396
RefSeq ORF 777
Synonyms FAM109B; IPIP27B; Ses2
Locus ID 150368
UniProt ID Q6ICB4
Cytogenetics 22q13.2
Summary Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHETA2" proteins (3)
SKU Description Size Price
LC424173 Lyophilized FAM109B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424173 Transient overexpression lysate of family with sequence similarity 109, member B (FAM109B) (as WB positive control) 100 ug
$436.00
TP316895 Recombinant protein of human family with sequence similarity 109, member B (FAM109B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products