OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Sialidase 3 (NEU3) (NM_006656) Human Mass Spec Standard

Be the first to review this product
SKU
PH316537
NEU3 MS Standard C13 and N15-labeled recombinant protein (NP_006647)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343356 Rabbit Polyclonal Anti-NEU3 Antibody
100 ul
$585.00
LY401990 Transient overexpression lysate of sialidase 3 (membrane sialidase) (NEU3) (as WB positive control) 100 ug
$665.00

Other products for "Sialidase 3 or NM_006656"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216537
Predicted MW 52.1 kDa
Protein Sequence
Protein Sequence
>RC216537 representing NM_006656
Red=Cloning site Green=Tags(s)

MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT
FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV
RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP
AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP
NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL
EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE
CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006647
RefSeq Size 2748
RefSeq ORF 1383
Synonyms SIAL3
Locus ID 10825
UniProt ID Q9UQ49
Cytogenetics 11q13.4
Summary This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. provided by RefSeq, Jul 2008
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Sialidase 3" proteins (3)
SKU Description Size Price
LC401990 Lyophilized NEU3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401990 Transient overexpression lysate of sialidase 3 (membrane sialidase) (NEU3) (as WB positive control) 100 ug
$665.00
TP316537 Recombinant protein of human sialidase 3 (membrane sialidase) (NEU3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products