OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ALLC (NM_018436) Human Mass Spec Standard

Be the first to review this product
SKU
PH316471
ALLC MS Standard C13 and N15-labeled recombinant protein (NP_060906)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344861 Rabbit Polyclonal Anti-ALLC Antibody - N-terminal region
100 ul
$585.00
LY413022 Transient overexpression lysate of allantoicase (ALLC), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ALLC or NM_018436"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216471
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC216471 representing NM_018436
Red=Cloning site Green=Tags(s)

MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQG
VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEEFEAIAELKSDDWSYLVPMTE
LKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATDPKEPADLVAIAFGGVCVGF
SNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTK
YFEGNAPDSCKVDGCILTTQEEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARL
TIVPDGGVSRLRLRGFPSSICLLRPREKPMLKFSVSFKANP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060906
RefSeq Size 1443
RefSeq ORF 1173
Synonyms ALC
Locus ID 55821
UniProt ID Q8N6M5
Cytogenetics 2p25.3
Summary Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.supplied by OMIM, Nov 2008
Protein Pathways Metabolic pathways, Purine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ALLC" proteins (3)
SKU Description Size Price
LC413022 Lyophilized ALLC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413022 Transient overexpression lysate of allantoicase (ALLC), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316471 Recombinant protein of human allantoicase (ALLC), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products