OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXL1 (NM_005250) Human Mass Spec Standard

Be the first to review this product
SKU
PH316442
FOXL1 MS Standard C13 and N15-labeled recombinant protein (NP_005241)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330240 Rabbit Polyclonal Anti-FOXL1 Antibody
100 ul
$525.00
LY417423 Transient overexpression lysate of forkhead box L1 (FOXL1) (as WB positive control) 100 ug
$436.00

Other products for "FOXL1 or NM_005250"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216442
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC216442 representing NM_005250
Red=Cloning site Green=Tags(s)

MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRV
TLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRR
RKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPG
TASPNEDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDE
LLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005241
RefSeq Size 1038
RefSeq ORF 1035
Synonyms FKH6; FKHL11; FREAC7
Locus ID 2300
UniProt ID Q12952
Cytogenetics 16q24.1
Summary This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. provided by RefSeq, Nov 2012
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXL1" proteins (3)
SKU Description Size Price
LC417423 Lyophilized FOXL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417423 Transient overexpression lysate of forkhead box L1 (FOXL1) (as WB positive control) 100 ug
$436.00
TP316442 Recombinant protein of human forkhead box L1 (FOXL1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products