OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p21 Ras (HRAS) (NM_005343) Human Mass Spec Standard

Be the first to review this product
SKU
PH316409
HRAS MS Standard C13 and N15-labeled recombinant protein (NP_005334)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505669 HRAS mouse monoclonal antibody,clone OTI1D9 100 ul
$447.00
LY401645 Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "p21 Ras or NM_005343"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216409
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC216409 representing NM_005343
Red=Cloning site Green=Tags(s)

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ
YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLVRSYGIP
YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005334
RefSeq Size 1061
RefSeq ORF 567
Synonyms C-BAS/HAS; C-H-RAS; C-HA-RAS1; CTLO; H-RASIDX; HAMSV; HRAS1; p21ras; RASH1
Locus ID 3265
UniProt ID P01112
Cytogenetics 11p15.5
Summary This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Endocytosis, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "p21 Ras" proteins (9)
SKU Description Size Price
PH325202 HRAS MS Standard C13 and N15-labeled recombinant protein (NP_001123914) 10 ug
$3,360.00
LC401645 Lyophilized HRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406123 Lyophilized HRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427210 Lyophilized HRAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401645 Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY406123 Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427210 Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP316409 Recombinant protein of human v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1, 20 µg 20 ug
$737.00
TP325202 Recombinant protein of human v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products