OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCNJ9 (NM_004983) Human Mass Spec Standard

Be the first to review this product
SKU
PH316336
KCNJ9 MS Standard C13 and N15-labeled recombinant protein (NP_004974)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351217 Rabbit Polyclonal Anti-KCNJ9 Antibody
100 ul
$205.00
LY417612 Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) (as WB positive control) 100 ug
$436.00

Other products for "KCNJ9 or NM_004983"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216336
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC216336 representing NM_004983
Red=Cloning site Green=Tags(s)

MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYAL
TWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLL
LQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLI
RSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMV
EATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLY
WSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004974
RefSeq Size 3029
RefSeq ORF 1179
Synonyms GIRK3; KIR3.3
Locus ID 3765
UniProt ID Q92806
Cytogenetics 1q23.2
Summary Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. It associates with another G-protein-activated potassium channel to form a heteromultimeric pore-forming complex. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KCNJ9" proteins (3)
SKU Description Size Price
LC417612 Lyophilized KCNJ9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417612 Transient overexpression lysate of potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9) (as WB positive control) 100 ug
$436.00
TP316336 Recombinant protein of human potassium inwardly-rectifying channel, subfamily J, member 9 (KCNJ9), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products