OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MED29 (NM_017592) Human Mass Spec Standard

Be the first to review this product
SKU
PH316296
MED29 MS Standard C13 and N15-labeled recombinant protein (NP_060062)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343222 Rabbit Polyclonal Anti-MED29 Antibody
100 ul
$585.00
LY413682 Transient overexpression lysate of mediator complex subunit 29 (MED29) (as WB positive control) 100 ug
$436.00

Other products for "MED29 or NM_017592"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216296
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC216296 representing NM_017592
Red=Cloning site Green=Tags(s)

MLKSNGERRSRNALPAVYARKMAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQ
QQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELC
LRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKT
PAPPAGPGGTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060062
RefSeq Size 3604
RefSeq ORF 663
Synonyms IXL; MED2
Locus ID 55588
UniProt ID Q9NX70
Cytogenetics 19q13.2
Summary MED29 is a subunit of the Mediator complex, a multiprotein coactivator of RNA transcription that interacts with DNA-bound transcriptional activators, RNA polymerase II (see MIM 180660), and general initiation factors (Sato et al., 2003 PubMed 14576168).supplied by OMIM, Aug 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MED29" proteins (3)
SKU Description Size Price
LC413682 Lyophilized MED29 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413682 Transient overexpression lysate of mediator complex subunit 29 (MED29) (as WB positive control) 100 ug
$436.00
TP316296 Recombinant protein of human mediator complex subunit 29 (MED29), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products