OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL32 (NM_001012633) Human Mass Spec Standard

Be the first to review this product
SKU
PH316048
IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012651)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306296 Rabbit Polyclonal IL-32 Antibody
100 ug
$640.00
LY422885 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "IL32 or NM_001012633"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216048
Predicted MW 14.7 kDa
Protein Sequence
Protein Sequence
>RC216048 representing NM_001012633
Red=Cloning site Green=Tags(s)

MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELT
PLFEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012651
RefSeq Size 919
RefSeq ORF 393
Synonyms IL-32alpha; IL-32beta; IL-32delta; IL-32gamma; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd
Locus ID 9235
UniProt ID P24001
Cytogenetics 16p13.3
Summary This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IL32" proteins (16)
SKU Description Size Price
PH317258 IL32 MS Standard C13 and N15-labeled recombinant protein (NP_001012736) 10 ug
$3,360.00
LC401352 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422819 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422884 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422885 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422886 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422889 Lyophilized IL32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401352 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422819 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 8 (as WB positive control) 100 ug
$436.00
LY422884 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422885 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422886 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY422889 Transient overexpression lysate of interleukin 32 (IL32), transcript variant 7 (as WB positive control) 100 ug
$436.00
TP316048 Recombinant protein of human interleukin 32 (IL32), transcript variant 4, 20 µg 20 ug
$867.00
TP317258 Recombinant protein of human interleukin 32 (IL32), transcript variant 8, 20 µg 20 ug
$867.00
TP761648 Purified recombinant protein of Human interleukin 32 (IL32), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products