OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C18orf1 (LDLRAD4) (NM_181483) Human Mass Spec Standard

Be the first to review this product
SKU
PH315558
C18orf1 MS Standard C13 and N15-labeled recombinant protein (NP_852148)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369865 LDLRAD4 rabbit polyclonal antibody
100 ul
$310.00
LY418054 Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b1 (as WB positive control) 100 ug
$436.00

Other products for "C18orf1 or NM_181483"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215558
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC215558 representing NM_181483
Red=Cloning site Green=Tags(s)

MAAELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQIMHAPRSRDRFTAPSF
IQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDS
DLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQN
NAESTIVPIKGKDRKPGNLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852148
RefSeq Size 8031
RefSeq ORF 690
Synonyms C18orf1
Locus ID 753
UniProt ID O15165
Cytogenetics 18p11.21
Summary Functions as a negative regulator of TGF-beta signaling and thereby probably plays a role in cell proliferation, differentiation, apoptosis, motility, extracellular matrix production and immunosuppression. In the canonical TGF-beta pathway, ZFYVE9/SARA recruits the intracellular signal transducer and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then form a heteromeric complex with SMAD4 that translocates to the nucleus to regulate transcription. Through interaction with SMAD2 and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent propagation of the intracellular signal.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C18orf1" proteins (7)
SKU Description Size Price
LC405781 Lyophilized LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418054 Lyophilized LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424094 Lyophilized LDLRAD4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405781 Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b2 (as WB positive control) 100 ug
$436.00
LY418054 Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant b1 (as WB positive control) 100 ug
$436.00
LY424094 Transient overexpression lysate of chromosome 18 open reading frame 1 (C18orf1), transcript variant c1 (as WB positive control) 100 ug
$436.00
TP315558 Purified recombinant protein of Homo sapiens chromosome 18 open reading frame 1 (C18orf1), transcript variant b2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products