OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

H1oo (H1FOO) (NM_153833) Human Mass Spec Standard

Be the first to review this product
SKU
PH315554
H1FOO MS Standard C13 and N15-labeled recombinant protein (NP_722575)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372730 H1-8 rabbit polyclonal antibody
100 ul
$310.00
LY406918 Transient overexpression lysate of H1 histone family, member O, oocyte-specific (H1FOO) (as WB positive control) 100 ug
$436.00

Other products for "H1oo or NM_153833"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215554
Predicted MW 35.6 kDa
Protein Sequence
Protein Sequence
>RC215554 representing NM_153833
Red=Cloning site Green=Tags(s)

MAPGSVTSDISPSSTSTAGSSRSPESEKPGPSHGGVPPGGPSHSSLPVGRRHPPVLRMVLEALQAGEQRR
GTSVAAIKLYILHKYPTVDVLRFKYLLKQALATGMRRGLLARPLNSKARGATGSFKLVPKHKKKIQPRKM
APATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQ
SGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKK
KVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_722575
RefSeq Size 1067
RefSeq ORF 1038
Synonyms H1.8; H1FOO; H1oo; osH1
Locus ID 132243
UniProt ID Q8IZA3
Cytogenetics 3q22.1
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The related mouse gene is expressed only in oocytes. provided by RefSeq, Oct 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "H1oo" proteins (3)
SKU Description Size Price
LC406918 Lyophilized H1FOO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406918 Transient overexpression lysate of H1 histone family, member O, oocyte-specific (H1FOO) (as WB positive control) 100 ug
$436.00
TP315554 Recombinant protein of human H1 histone family, member O, oocyte-specific (H1FOO), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products