OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAPP1 (NM_014395) Human Mass Spec Standard

Be the first to review this product
SKU
PH315474
DAPP1 MS Standard C13 and N15-labeled recombinant protein (NP_055210)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810236 DAPP1 mouse monoclonal antibody,clone OTI7D4 100 ul
$447.00
LY402326 Transient overexpression lysate of dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1) (as WB positive control) 100 ug
$436.00

Other products for "DAPP1 or NM_014395"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215474
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC215474 representing NM_014395
Red=Cloning site Green=Tags(s)

MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE
SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL
TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055210
RefSeq Size 2953
RefSeq ORF 840
Synonyms BAM32
Locus ID 27071
UniProt ID Q9UN19
Cytogenetics 4q23
Summary May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Phosphatase
Protein Pathways B cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAPP1" proteins (3)
SKU Description Size Price
LC402326 Lyophilized DAPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402326 Transient overexpression lysate of dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1) (as WB positive control) 100 ug
$436.00
TP315474 Recombinant protein of human dual adaptor of phosphotyrosine and 3-phosphoinositides (DAPP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products