OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TBCEL (NM_152715) Human Mass Spec Standard

Be the first to review this product
SKU
PH315292
TBCEL MS Standard C13 and N15-labeled recombinant protein (NP_689928)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502672 TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9) 100 ul
$447.00
LY407335 Transient overexpression lysate of tubulin folding cofactor E-like (TBCEL), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "TBCEL or NM_152715"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215292
Predicted MW 48.2 kDa
Protein Sequence
Protein Sequence
>RC215292 protein sequence
Red=Cloning site Green=Tags(s)

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIA
AFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASW
ETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANN
HLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIAR
LPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHF
NDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVE
SKTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689928
RefSeq Size 4041
RefSeq ORF 1272
Synonyms El; LRRC35
Locus ID 219899
UniProt ID Q5QJ74
Cytogenetics 11q23.3
Summary Acts as a regulator of tubulin stability.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TBCEL" proteins (7)
SKU Description Size Price
PH325691 TBCEL MS Standard C13 and N15-labeled recombinant protein (NP_001123519) 10 ug
$3,360.00
LC407335 Lyophilized TBCEL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427127 Lyophilized TBCEL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407335 Transient overexpression lysate of tubulin folding cofactor E-like (TBCEL), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427127 Transient overexpression lysate of tubulin folding cofactor E-like (TBCEL), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP315292 Recombinant protein of human tubulin folding cofactor E-like (TBCEL), transcript variant 1, 20 µg 20 ug
$867.00
TP325691 Recombinant protein of human tubulin folding cofactor E-like (TBCEL), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products