OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C19orf63 (EMC10) (NM_175063) Human Mass Spec Standard

Be the first to review this product
SKU
PH315076
C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372144 EMC10 rabbit polyclonal antibody
100 ul
$310.00
LY406303 Transient overexpression lysate of chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 (as WB positive control) 100 ug
$436.00

Other products for "C19orf63 or NM_175063"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215076
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC215076 representing NM_175063
Red=Cloning site Green=Tags(s)

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK
RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES
HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA
QKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_778233
RefSeq Size 2740
RefSeq ORF 762
Synonyms C19orf63; HSM1; HSS1
Locus ID 284361
UniProt ID Q5UCC4
Cytogenetics 19q13.33
Summary Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C19orf63" proteins (5)
SKU Description Size Price
LC406303 Lyophilized EMC10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406303 Transient overexpression lysate of chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1 (as WB positive control) 100 ug
$436.00
TP315076 Recombinant protein of human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, 20 µg 20 ug
$737.00
TP700056 Recombinant protein of secreted form of human HSS1 with DDK/His tag, expressed in human cells, 20ug 20 ug
$900.00
TP760930 Purified recombinant protein of Human chromosome 19 open reading frame 63 (C19orf63), transcript variant HSS1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products