OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRSAM1 (NM_138361) Human Mass Spec Standard

Be the first to review this product
SKU
PH315025
LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_612370)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359285 LRSAM1 Antibody - N-terminal region
100 ul
$585.00
LY434379 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 4 (as WB positive control) 100 ug
$665.00

Other products for "LRSAM1 or NM_138361"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215025
Predicted MW 83.6 kDa
Protein Sequence
Protein Sequence
>RC215025 protein sequence
Red=Cloning site Green=Tags(s)

MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSL
LPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLK
ELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAILQFLCKESGL
EYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQRE
HTQLLQQSSSQKDEILQTVKEEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK
KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS
MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLEL
KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKP
LSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELL
DAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC
QPLRTCPLCRQDIAQRLRIYHSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612370
RefSeq Size 3405
RefSeq ORF 2169
Synonyms CMT2P; RIFLE; TAL
Locus ID 90678
UniProt ID Q6UWE0
Cytogenetics 9q33.3-q34.11
Summary This gene encodes a ring finger protein involved in a variety of functions, including regulation of signaling pathways and cell adhesion, mediation of self-ubiquitylation, and involvement in cargo sorting during receptor endocytosis. Mutations in this gene have been associated with Charcot-Marie-Tooth disease. Multiple transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Jan 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRSAM1" proteins (13)
SKU Description Size Price
PH300920 LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005373) 10 ug
$3,360.00
PH323778 LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005374) 10 ug
$3,360.00
LC408632 Lyophilized LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423706 Lyophilized LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423707 Lyophilized LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434379 Lyophilized LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408632 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423706 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423707 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY434379 Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP300920 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2, 20 µg 20 ug
$867.00
TP315025 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1, 20 µg 20 ug
$867.00
TP323778 Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products