OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2E1 (NM_182666) Human Mass Spec Standard

Be the first to review this product
SKU
PH314934
UBE2E1 MS Standard C13 and N15-labeled recombinant protein (NP_872607)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA309924 Rabbit Polyclonal UBCH6 Antibody
100 ul
$585.00
LY405441 Transient overexpression lysate of ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "UBE2E1 or NM_182666"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214934
Predicted MW 19.3 kDa
Protein Sequence
Protein Sequence
>RC214934 representing NM_182666
Red=Cloning site Green=Tags(s)

MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPP
GSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLT
DCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872607
RefSeq Size 1428
RefSeq ORF 528
Synonyms UBCH6
Locus ID 7324
UniProt ID P51965
Cytogenetics 3p24.2
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Jan 2011
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2E1" proteins (3)
SKU Description Size Price
LC405441 Lyophilized UBE2E1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405441 Transient overexpression lysate of ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP314934 Recombinant protein of human ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast) (UBE2E1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products