OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOCS2 (NM_176806) Human Mass Spec Standard

Be the first to review this product
SKU
PH314804
MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_789776)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406129 Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MOCS2 or NM_176806"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214804
Predicted MW 9.6 kDa
Protein Sequence
Protein Sequence
>RC214804 representing NM_176806
Red=Cloning site Green=Tags(s)

MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQL
LVLQPGDEIAVIPPISGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789776
RefSeq Size 1347
RefSeq ORF 264
Synonyms MCBPE; MOCO1; MOCODB; MPTS
Locus ID 4338
UniProt ID O96033
Cytogenetics 5q11.2
Summary Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOCS2" proteins (7)
SKU Description Size Price
PH308485 MOCS2 MS Standard C13 and N15-labeled recombinant protein (NP_004522) 10 ug
$3,360.00
LC406129 Lyophilized MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417924 Lyophilized MOCS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406129 Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY417924 Transient overexpression lysate of molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP308485 Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3, 20 µg 20 ug
$867.00
TP314804 Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products