OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF205 (NM_003456) Human Mass Spec Standard

Be the first to review this product
SKU
PH314738
ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_003447)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343409 Rabbit Polyclonal Anti-ZNF205 Antibody
100 ul
$525.00
LY418666 Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ZNF205 or NM_003456"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214738
Predicted MW 60.6 kDa
Protein Sequence
Protein Sequence
>RC214738 protein sequence
Red=Cloning site Green=Tags(s)

MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDAQESLHIKMEPEEPHSEGASQEDGAQGA
WGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGR
LDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTS
SVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPE
KPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSH
LIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH
LTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003447
RefSeq Size 2077
RefSeq ORF 1662
Synonyms RhitH; Zfp13; ZNF210
Locus ID 7755
UniProt ID O95201
Cytogenetics 16p13.3
Summary May be involved in transcriptional regulation.UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF205" proteins (8)
SKU Description Size Price
PH301174 ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_001035893) 10 ug
$3,360.00
LC418666 Lyophilized ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420898 Lyophilized ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418666 Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420898 Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301174 Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 2, 20 µg 20 ug
$737.00
TP314738 Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 1, 20 µg 20 ug
$737.00
TP761639 Purified recombinant protein of Human zinc finger protein 205 (ZNF205), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products